
dintur.se Online

1,071 site pages are viewed per day. The analyzed website's PageRank is 4 out of 10. The average time of page load on this site is 1.48 seconds. Total age of dintur.se is 16 years 1 months 4 days. According to the data obtained from Alexa.com, the rank of dintur.se in the internet is #851,063. About 369 users visit dintur.se every day. dintur.se is listed in DMOZ. IP address of dintur.se is, country where the site was registered - Sweden.. The total daily traffic of the site is 44.9MB (Sweden is the main traffic source). Our analysis says that the daily revenue of the site is 1.23 $ per day and its estimated worth - 575.31 $. The lower Alexa Traffic Rank has the analyzed the higher its popularity among Internet users and they visit it more often

Web Site Analytics

Traffic volume(per day)44.9MB
Rank in primary countryn/a
Amount of visitors per day369
Backlinks by Alexa107
Alexa rank#851,063
Google PR4
Mean Time Load1.48
Google backLinks5,450
Pages viewed(per day)1,071
Daily revenue from ads1.23 $
Traffic volume(per month)1.3GB
Server locationSweden
Pages in Google SERP822
Title dintur.se
Yandex CY0
Adult rating18+
Website worth575.31 $
Hosting ip address85.8.46.211
Alexa main countryn/a

Alexa Traffic Graph Analysis

Site Info by Alexa
Traffic Rank

Low Traffic Rank indicates that the analyzed website gets a lot of visitors.

Traffic RankTrend

Daily reach - average percentage of total Internet users visiting the analyzed website.


Average percentage of global pageviews.


Average percentage of daily unique pegeviews per visitor.


Average percentage of site visits consisting of one pageview.

Time on site

Estimated average time spent on site.

Time on siteTrend

Average percentage of total World Wide Web users that come to the analyzed site from various search engines.


Website Traffic Stats By Alexa

dintur.se has #851,063 rank in the Internet. Such rank indicates the popularity of the analyzed site. Low rank shows that this site gets a lot of visits. n/a is the main source of site visits. n/a - is the site’s rank in n/a. 369 users visit it daily, and 1,071 pages are viewed per day. By clicking on the tabs below you will get more detailed information.

Top Queries

Top-rated keywords from site title.

1din tur59.19%
2östersund näsåker avstånd4.36%
3dintur se4.32%
5sundsvall buss3.39%
7buss umeå kramfors2.91%
8sundsvall busstider2.89%
9din tur.se2.59%
10min tur1.89%

Keywords Popularity And Competition

Query Popularity represents the indicator of how often users use keywords in the search. The higher this indicator, the higher the rate of search queries. Competition indicator represents the advertising competition for a search query and is based on the number of displayed ads for a keyword in search engines.

No.QueryImpact FactorQuery PopularityCompetition
2buss umeå21.21
6sundsvall till ånge9.20
11din türen0.23

HTML Analysis

HTML size42.9KB
Int. links42
Ext. links7

Website Metatags Preview

There are 1 meta tags on dintur.se.

viewportinitial-scale = 1.0,maximum-scale = 1.0

HTTP Headers

HTTP header of dintur.se.

cache-control  private
content-type  text/html; charset=utf-8
expires  Mon, 13 May 2013 18:03:18 GMT
server  Microsoft-IIS/7.5
set-cookie  ASP.NET_SessionId=mwe4o3vswsqocytzpze43eht; path=/; HttpOnly
x-aspnet-version  4.0.30319
x-powered-by  ASP.NET
date  Tue, 14 May 2013 18:03:17 GMT
content-length  43996

Domain Name Analysis

dintur.se is 16 years, 1 month, 4 days old. Expiration date - 2013-12-31.

Name Serverdns1.lank.se
Total Age16 years, 1 month, 4 days

Website server position on map - server's IP address, Sweden - country of registration

Analysis of external and internal links

Internal and external links ratio. Our analysis shows that the index page of the analyzed site dintur.se has 7 external and 42 internal links.

Websites Last Checked



Domain Worth: 84 $ Google PR: 0 Daily Visits: 37

briarpatch - an award-winning maker of games, puzzles and card games -updated

Domain Worth: 190.67 $ Google PR: 3 Daily Visits: 124

helmholtz-zentrum berlin (hzb) - home

naturwissenschaftliches forschungszentrum

Domain Worth: 14 $ Google PR: 7 Daily Visits: 5

etusivu - savo-karjalan elã¤inlã¤ã¤kã¤riseura

Google PR: 2

icosmogeek - technology blog

technology news blog covering apple, google, microsoft, social media and the web!

Domain Worth: 242.45 $ Google PR: 2 Daily Visits: 185

adsl, kabel en glasvezel aanbiedingen - bestellen - shopadsl.nl


Domain Worth: 308 $ Google PR: 3 Daily Visits: 132

tim lee photography, architectural photography for advertising and commercial use

architectural photographer with expertise in lighting and composition capturing interior and exterior photographs for commercial and advertising use

Domain Worth: 21 $ Google PR: 2 Daily Visits: 8

blogu' lu' kaz3 - www.kaz3.info

blog de it, software, hardware, reviews

Domain Worth: 2,076.81 $ Google PR: 3 Daily Visits: 1,501

innovation consulting firm | innosight

innosight is an innovation consulting firm co-founded by clay christensen. we help organizations create sustainable growth through innovation.

Domain Worth: 968.66 $ Google PR: 6 Daily Visits: 606

департамент образования ивановской области

Domain Worth: 807.09 $ Google PR: 4 Daily Visits: 501

hunlian.cn, disfrazzes.com, dresden01.de, camillebeckmanonline.com, vicenzae.org, templatebar.de, youhavemetmeataverystrangetimeinmylife.wordpress.com, crazyfit.ie, bearhatstudios.com, superlaugh.com, varesan-host.com